PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010548327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family ZF-HD
Protein Properties Length: 307aa    MW: 35337.4 Da    PI: 8.0868
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010548327.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.5e-3199155259
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++vrY+eC++NhAas Ggh+vDGCgEfm++ geegt++ l+CaAC+CHR+FHRre + 
  XP_010548327.1  99 QQVRYRECQRNHAASSGGHVVDGCGEFMAA-GEEGTPEYLRCAACDCHRSFHRREIDG 155
                     789**************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2584163IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-29100153IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.9E-28102153IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.048103152IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.23E-17239304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-27239306IPR009057Homeodomain-like
PROSITE profilePS500719.458241305IPR001356Homeobox domain
TIGRFAMsTIGR015656.4E-27243300IPR006455Homeodomain, ZF-HD class
CDDcd000860.00534244306No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEVGEKEKEM EMPSSFRYCT SSTDHHERRR KPATDHQTLY HHHRPPPPHI YHETAEKNKP  60
TSRDSDSDPE PEPVSATPVS PLPRSYARPF PHLYQQQQQQ VRYRECQRNH AASSGGHVVD  120
GCGEFMAAGE EGTPEYLRCA ACDCHRSFHR REIDGEITLN LNTYGHYSVV ATGNVWSQRN  180
LVSPPPQHQP TPPGLLLHHH HHVCPIMMSF GGGGGPAESS TEDLNKFHQS LGAIGIDQLQ  240
QPRKRSRTKF SQEQKEKMEE FADKISWRIT KQDEEEVQRF CSQINVKRQV FKVWMHNNKQ  300
ASRKKHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-182432991773ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010548327.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-100ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JR931e-107A0A078JR93_BRANA; BnaCnng66730D protein
STRINGscaffold_304185.11e-101(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-96homeobox protein 24